Peptide
Reference library
Educational peptide reference — research use only.
Research & educational use only
For laboratory and educational research only. Not for human or veterinary consumption. This is not medical advice. Always follow applicable laws and consult qualified professionals.
The calculator performs unit math for research reference. It must not be used to plan or guide dosing in humans or animals. Verify all figures independently in your lab protocol.
LL-37
An antimicrobial host-defense peptide studied in immune and wound-healing research.
- Half-life (approx.)
- Short — protease sensitive (approx.)
- Diluent
- Bacteriostatic water (0.9% benzyl alcohol)
- Common vials
- 5, 10 mg
Half-life figures are literature approximations for educational reference — not pharmacokinetic advice.
Overview
LL-37 is the only cathelicidin-derived antimicrobial peptide in humans, studied in innate immunity, wound healing, and autoimmunity research. It bridges dermatology and immunology literature with broad pathogen and biofilm models. Human cathelicidin antimicrobial peptide with innate immune and membrane-disruption roles.
Structure & identity
37-mer cathelicidin [LL-37, 37 aa]
- Sequence / structure
- 37-mer cathelicidin [LL-37, 37 aa]
Mechanism
Cathelicidin antimicrobial peptide disrupts bacterial membranes and modulates immune-cell chemotaxis. Dual antimicrobial and immunomodulatory profile studied in biofilm and psoriasis models.
Studies & clinical programs
Biofilm disruption assays
Published research models
- Peer-reviewed literature documents endpoints under Biofilm disruption assays experimental designs.
Psoriasis skin models
Published research models
- Peer-reviewed literature documents endpoints under Psoriasis skin models experimental designs.
Wound infection
Published research models
- Peer-reviewed literature documents endpoints under Wound infection experimental designs.
Research models in literature
- Biofilm disruption assays
- Psoriasis skin models
- Wound infection
Literature highlights
- Cathelicidin antimicrobial peptide disrupts bacterial membranes in biofilm assays.
- Innate immune chemotaxis and psoriasis skin models examine immunomodulatory roles.
- Protease-sensitive 37-mer — stability research emphasizes formulation and delivery.
Combination research notes
Immune research groups LL-37 with thymosin alpha-1 and KPV anti-inflammatory peptides.
Key targets & pathways
Research areas
Routes in research literature
Also known as
Stability & storage phases
| Phase | Condition | Guidance |
|---|---|---|
| Lyophilized | Sealed vial, refrigerated (2–8 °C) | Intact lyophilized cake or powder is typically stable for months to years per published stability data; protect from moisture, light, and repeated freeze-thaw of the dry vial. |
| Reconstituted | Bacteriostatic water (0.9% benzyl alcohol), refrigerated | Most aqueous peptide solutions remain usable for approximately 2–4 weeks refrigerated; verify published stability data and label with reconstitution date. |
| Working aliquots | Pre-drawn syringes or microtubes, frozen (−20 °C) | Aliquot promptly after mixing to limit freeze-thaw cycles on the main vial; thaw once and use to reduce protease-mediated degradation. |
Stability windows are formulation-dependent — verify published data and your lab SOP.
Reconstitution reference table
| Vial (mg) | Diluent (mL) | mcg/mL | Units @ 100 mcg | Units @ 250 mcg | Units @ 500 mcg |
|---|---|---|---|---|---|
| 5 | 2 | 2500.0 | 4 | 10 | 20 |
| 10 | 2 | 5000.0 | 2 | 5 | 10 |
U-100 insulin syringe scale (100 units = 1 mL). Illustrative only — not dosing guidance.
Reconstitution steps
- Allow vial to reach room temperature (15–30 min)
- Swab rubber stopper with alcohol prep pad
- Draw calculated bacteriostatic water into syringe
- Inject diluent slowly down vial wall — do not spray directly onto cake
- Gently swirl until fully dissolved — do not shake vigorously
- Label with date, concentration, and diluent volume
- Refrigerate and use within your lab stability window
Typically reconstituted with 1–2 mL bacteriostatic water.
Laboratory record checklist
- Compound identity recorded in lab notebook (name, lot, preparation date)
- Analytical identity cross-checked against published sequence or structure
- Potency or concentration documented from analytical certificate when available
- Purity or HPLC data filed when provided with research material
- Appearance noted: intact lyophilized cake or uniform powder
- Sterility / endotoxin report archived when available
- Storage temperature applied immediately per published stability guidance